Vergleich

EGF Europäischer Partner

ArtNr RLT-100-008
Hersteller ReliaTech
Menge 100ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Epidermal growth factor, EGF, URG, HOMG4, Urogastrone,
Lieferbar
NCBI Gene ID
1950
Uniprot
P01133
Biological Activity
The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Buffer
PBS
Description
Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGFa, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin-binding EGF-like growth factor (HBEGF), epigen, and the neuregulins (NRG) 1 through 6. Members of the EGF family share a structural motif, the EGF-like domain, which is characterized by three intra-molecular disulfide bonds that are formed by six similarly spaced conserved cysteine residues. All EGF family members are synthesized as type I transmembrane precursor proteins that may contain several EGF domains in the extracellular region. The mature proteins are released from the cell surface by regulated proteolysis. The 1207 amino acid (aa) human EGF precursor contains nine EGF domains and nine LDLR class B repeats. The mature protein consists of 53 aa and is generated by proteolytic excision of the EGF domain proximal to the transmembrane region. Mature human EGF shares 70% aa sequence identity with mature mouse and rat EGF. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid. Four ErbB (HER) family receptor tyrosine kinases including EGFR/ErbB1, ErbB2, ErbB3 and ErbB4, mediate responses to EGF family members. EGF binds ErbB1 and depending on the context, induces the formation of homodimers or heterodimers containing ErbB2. Biological activities ascribed to EGF include epithelial development, angiogenesis, inhibition of gastric acid secretion, fibroblast proliferation, and colony formation of epidermal cells in culture.
Length [aa]
54
Molecular Weight
6.35 kDa
mRNA RefSeq
NM_1963.4
N Terminal Sequence
MNSDSECPLS
Protein RefSeq
NP_001954.2
Protein Sequence
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Purity Confirmation
> 95% by SDS-PAGE & silver stain
Reconstitution
We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.
Stability And Storage
The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20 °C. Reconstituted EGF should be stored in working aliquots at -20 °C.
Synonyms
Epidermal growth factor; EGF; URG; HOMG4; Urogastrone;
Uniprot ID
P01133

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen