Vergleich

FGF-2 (basic) Europäischer Partner

ArtNr RLT-300-002
Hersteller ReliaTech
Menge 25ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias FGF2, BFGF, FGFB, HBGF-2, basic Fibroblast growth factor (bFGF), Heparin binding growth factor-2
Lieferbar
NCBI Gene ID
2247
Uniprot
P09038
Biological Activity
The ED50 for stimulation of cell proliferation in human umbilical vein endothelial cells by human FGF-2 (basic) has been determined to be in the range of 0.1-2 ng/ml.
Buffer
PBS
Description
FGF basic (FGF2, HBGF2) is one of at least 23 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21-24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH3T3 cells. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine and sheep FGF basic. Autocrine, intracrine and paracrine actions of FGF basic have been identified. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis reminiscent of a variety of pathological conditions.
Endotoxin Levels
< 0.1 ng per µg of human FGF-2
Length [aa]
153
Molecular Weight
17.0 kDa
mRNA RefSeq
NM_002006.4
N Terminal Sequence
AGSITTL
Protein RefSeq
NP_001997.5
Protein Sequence
AGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity Confirmation
> 98% by SDS-PAGE & silver stain
Reconstitution
The lyophilized FGF-2 (basic) should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin.
Stability And Storage
Lyophilized samples are stable for greater than six months at -20 °C to -70 °C.
Synonyms
FGF2; BFGF; FGFB; HBGF-2; basic Fibroblast growth factor (bFGF); Heparin binding growth factor-2
Uniprot ID
P09038

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 25ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen