Vergleich

HGF Europäischer Partner

ArtNr RLT-300-011
Hersteller ReliaTech
Menge 25ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against Human (Homo sapiens)
Host Insect Cells
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias HGF, SF, HGFB, HPTA, F-TCF, DFNB39, Hepatocyte growth factor, Scatter factor, rh HGF
Lieferbar
NCBI Gene ID
3082
Uniprot
P14210
Biological Activity
The activity was assayed for scattering activity in the MDCK cell assay. The ED50 was for this effect is typically at 1.0 - 5.0 ng/ml.
Buffer
50 mM acetic acid
Description
Human Hepatocyte Growth Factor (HGF), also known as scatter factor, is a pleiotropic cytokine that shows homology to the enzymes of the blood coagulation cascade. It stimulates the motility and invasion of several cancer cell types and can induce angiogenesis. Recently HGF was found to be identical to scatter factor, a fibroblast-derived factor promoting the dissociation of epithelial and vascular endothelial cell colonies in monolayer cell cultures by stimulating cell migration. HGF is synthesized as a biologically inactive single chain precursor, which is cleaved by a specific, extracellular serum serine protease to a fully active heterodimer. This mature, biologically active HGF consists of a disulfide-linked alpha-beta heterodimer of the two cleavage products. Previous studies have shown that single chain and heterodimeric HGF are equally active in vitro assay systems due to either production of the serine protease in cell culture or the presence of the ubiquitous protease in serum. All biological responses induced by HGF are elicited by binding to its transmembrane tyrosine kinase receptor, which is encoded by the MET proto-oncogene. After autophosphorylation of the receptor different cytoplasmic effectors are activated that bind to the same multifunctional docking site of the receptor. HGF function is essential for normal development. Knockout studies have demonstrated that both ligand and receptor deficient mice display an embryonic lethal phenotype. Hepatocytes have to be primed before they can fully respond to HGF. This priming requires cytokines as TNF and IL-6. Recent studies have suggested that HGF synergizes with basic FGF in the induction of angiogenesis.
Length [aa]
692
Molecular Weight
78.0 kDa
mRNA RefSeq
NM_000601
N Terminal Sequence
MAPARSPST
Protein RefSeq
NP_000592
Protein Sequence
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADN
Purity Confirmation
> 95% by SDS-PAGE & silver stain
Reconstitution
The lyophilized human HGF is soluble in acetic acid (50 mM) and can be reconstituted to a concentration of 100 µg/ml. Further dilutions should be made into buffer containing protein or medium containing serum.
Stability And Storage
The lyophilized HGF, though stable at room temperature, is best stored desiccated below 0 °C. Reconstituted it should be stored in working aliquots at -20 °C to -70 °C. Avoid repeated freeze-thaw cycles.
Synonyms
HGF; SF; HGFB; HPTA; F-TCF; DFNB39; Hepatocyte growth factor; Scatter factor; rh HGF
Uniprot ID
P14210

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 25ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen