Vergleich

PlGF-1 Europäischer Partner

ArtNr RLT-300-015
Hersteller ReliaTech
Menge 5ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against Human (Homo sapiens)
Host Insect Cells
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias PlGF, placental growth factor
Lieferbar
NCBI Gene ID
5281
Uniprot
P49763
Biological Activity
Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PlGF-1 can bind to immobilized rh-sFlt-1 (100ng/well) with a linear range at 0.5 - 10ng/ml.
Buffer
50mM acetic acid
Description
Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversial. In several reports it was shown not to be a potent mitogen for endothelial cells and not angiogenic in vivo by using different assays. Very recently it was shown by one investigator, that PlGF-1 from cell culture supernatants was angiogenic in the CAM assay and in the rabbit cornea assay. At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes) but PlGF does not bind to KDR/flk-1. Two different proteins can be generated by differential splicing of the human PlGF gene: PlGF-1 (131aa native chain) and PlGF-2 (152aa native chain). Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF-1 is a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses a similar biological profile. There is good evidence that heterodimeric molecules between VEGF and PlGF exists and that they are biological active. Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A closely related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.
Length [aa]
131
Molecular Weight
~ 34.0 kDa
mRNA RefSeq
NM_001207012.1
Protein RefSeq
NP_001193941.1
Protein Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR
Purity Confirmation
> 95% by SDS-PAGE & visualized by silver stain
Reconstitution
Centrifuge vial prior to opening. The PlGF-1 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.
Stability And Storage
The lyophilized human PlGF-1, though stable at room temperature, is best stored in working aliquots at -20 °C to -70 °C. Avoid repeated freeze-thaw cycles.
Stabilizer/Carrier
BSA (50-fold)
Synonyms
PlGF; placental growth factor
Uniprot ID
P49763

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen