Vergleich

PRAME Europäischer Partner

ArtNr RLT-400-016
Hersteller ReliaTech
Menge 20ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against Human (Homo sapiens)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Melanoma antigen preferentially expressed in tumors, Opa-interacting protein 4, MAPE, OIP4
Lieferbar
NCBI Gene ID
23532
Uniprot
P78395
Biological Activity
Positive control for WB.
Buffer
10mM Tris, 25 mM NaP, pH 7.4
Description
PRAME/MAPE/OIP4 is a germinal tissue-specific gene that is also expressed at high levels in haematological malignancies and solid tumors. The physiological functions of PRAME in normal and tumor cells are unknown, although a role in the regulation of retinoic acid signaling has been proposed. Sequence homology and structural predictions suggest that PRAME is related to the Leucine-rich repeat (LRR) family of proteins, which have diverse functions. PRAME, or „preferentially expressed antigen in melanoma”, was originally identified as a gene encoding a HLA-A24 restricted antigenic peptide presented to autologous tumor-specific cytotoxic T lymphocytes derived from a patient with melanoma. PRAME is synonymous with MAPE (melanoma antigen preferentially expressed in tumors) and OIP4 (OPA-interacting protein 4), and its expression profile defines it as a cancer-testis antigen. Cancer-testis antigens (CTAs) are encoded by non-mutated genes expressed at high levels in germinal tissues and tumors, but which are absent from or detected at low levels in other tissues. PRAME may be somewhat different to other cancer-testis antigens in that it shows some expression in normal tissues such as ovary, adrenal, placenta and endometrium. The C-terminus of human PRAME (amino acids 453-509) was also identified to bind Neisseria gonorrhoeae opacity factors, in this case the OPA-P protein. Thus PRAME is also known as OIP4 (OPA interacting protein), although the functional implications of the interaction are unknown.
Length [aa]
106
Molecular Weight
10.7 kDa
mRNA RefSeq
NM_006115.3
Protein RefSeq
NP_006106.1
Protein Sequence
MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
Purity Confirmation
> 98 by SDS-PAGE & visualized by silver stain
Reconstitution
Centrifuge vial prior to opening. Human PRAME should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20 °C
Stability And Storage
The lyophilized human PRAME, though stable at room temperature, is best stored desiccated below 0 °C. Reconstituted human PRAME should be stored in working aliquots at -20 °C.
Synonyms
Melanoma antigen preferentially expressed in tumors; Opa-interacting protein 4; MAPE, OIP4
Uniprot ID
P78395

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen