FABP5

ArtNr	RLT-400-024S
Hersteller	ReliaTech
Menge	5ug
Kategorie	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Obesity Lipid & Fatty Acid Transport
Typ	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP
Lieferbar
NCBI Gene ID	2171
Uniprot	Q01469
Biological Activity	Data not available.
Description	Human FABP5, also known as epidermal fatty acid binding protein (E-FABP), is a 15 kDa member of a cytosolic fatty acid binding protein superfamily. It is associated with keratinocytes and adipocytes and is suggested to promote fatty acid availability to enzymes, protect cell structures from fatty acid attack, and target fatty acids to nuclear transcription factors. The amino acid sequence of human FABP5 is 80%, 81% and 92% identical to that of mouse, rat and bovine FABP5, respectively.
Label	His-Tag
Length [aa]	143
Molecular Weight	16.1 kDa
mRNA RefSeq	NM_001444
Protein RefSeq	NP_001435
Protein Sequence	MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVETRHHHHHH
Purity Confirmation	> 98% by SDS-PAGE & visualized by Coomassie stain
Synonyms	Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP
Uniprot ID	Q01469

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5ug

lieferbar

Lieferung vsl. bis 21.08.2025

Express-Lieferung: 17 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern