Vergleich

FGF-2 (basic) Europäischer Partner

ArtNr RLT-M30-014
Hersteller ReliaTech
Menge 10ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Fgf2, Fgfb, bFGF, Fgf-2
Lieferbar
NCBI Gene ID
14173
Uniprot
P15655
Biological Activity
The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for mouse FGF-2 has been determined to be in the range of 0.1-2 ng/ml.
Buffer
PBS
Description
The FGF family is composed of at least 23 polypeptides that show a variety of biological activities towards cells of mesenchymal, neuronal and epithelial origin. All members are heparin-binding growth factors (HB-GF). Until the structure of basic fibroblast growth factor (bFGF/FGF-2) was determined, a number of synonyms was used to describe this growth factor. As is often the case, the nomenclature reflected the observed activities reported by individual groups. Basic FGF has been reported as leukemia growth factor, macrophage growth factor, endothelial growth factor and tumor angiogenesis factor. The eventual isolation and characterization of bFGF was done from soluble brain extracts. bFGF was found to have a molecular mass of 16.5 kDa and to be 154 amino acids in length. Interestingly, bFGF contains no hydrophobic leader sequence previously thought to be required for cell secretion. Basic FGF bears 55% homology to acidic FGF and also seems to exist in three forms: the 154 amino-acid form and two other truncated versions of 146 and 131 amino acids lacking the N-terminal 9 and 24 residues. Acidic and basic FGF compete for the binding to 125 kDa and 145 kDa receptor species. However, acidic FGF has a higher affinity for the 125 kDa species, while basic FGF has a higher affinity for the 145 kDa species. FGF receptor activation leads to the activation of MAP kinase and protein kinase C. FGF’s induce the proliferative response in cells derived from mesoderm and neuroectoderm. It seems that basic FGF reduces the average doubling time by shortening the G1 phase of the cell cycle. Furthermore, it has been reported to induce the release of plasminogen activator by endothelial cells. Perhaps one of the most potentially significant applications of bFGF is related to its reported ability to induce angiogenesis.
Endotoxin Levels
< 0.1 ng per µg of mouse FGF-2
Length [aa]
144
Molecular Weight
16.35 kDa
mRNA RefSeq
NM_008006.2
N Terminal Sequence
ALPEDDGG
Protein RefSeq
NP_032032.1
Protein Sequence
ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity Confirmation
> 98% by SDS-PAGE & visualized by silver stain
Reconstitution
The lyophilized basic FGF should be reconstituted in water containing at least 0.1% human or bovine serum albumin to a concentration not lower than 10µg/ml.
Stability And Storage
Lyophilized samples are stable for greater than six months at -20 °C to -70 °C. Basic FGF can be stored in high-salt buffer (PBS, 1M NaCl) at 4 °C for 2-4 weeks.
Synonyms
Fgf2; Fgfb; bFGF; Fgf-2
Uniprot ID
P15655

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen