Vergleich

FGF-2 (basic) Europäischer Partner

ArtNr RLT-R20-059
Hersteller ReliaTech
Menge 10ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against Rat (Rattus norvegicus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Fgf2, bFGF, Fgf-2
Lieferbar
NCBI Gene ID
54250
Uniprot
P13109
Biological Activity
The ED50 for stimulation of cell proliferation in human umbilical vein endothelial cells (HUVEC) by mouse FGF-2 has been determined to be in the range of 0.1-2 ng/ml.
Buffer
0.5X PBS
Description
The FGF family is composed of at least 23 polypeptides that show a variety of biological activities towards cells of mesenchymal, neuronal and epithelial origin. All members are heparin-binding growth factors (HB-GF). Until the structure of basic fibroblast growth factor (bFGF/FGF-2) was determined, a number of synonyms were used to describe this growth factor. As is often the case, the nomenclature reflected the observed activities reported by individual groups. Basic FGF has been reported as leukemia growth factor, macrophage growth factor, endothelial growth factor and tumor angiogenesis factor. The eventual isolation and characterization of bFGF was done from soluble brain extracts. bFGF was found to have a molecular mass of 16.5 kDa and to be 154 amino acids in length. Interestingly, bFGF contains no hydrophobic leader sequence previously thought to be required for cell secretion. Basic FGF bears 55% homology to acidic FGF and also seems to exist in three forms: the 154 amino-acid form and two other truncated versions of 146 and 131 amino acids lacking the N-terminal 9 and 24 residues. Acidic and basic FGF compete for the binding to 125 kDa and 145 kDa receptor species. However, acidic FGF has a higher affinity for the 125 kDa species, while basic FGF has a higher affinity for the 145 kDa species. FGF receptor activation leads to the activation of MAP kinase and protein kinase C. FGF’s induce the proliferative response in cells derived from mesoderm and neuroectoderm. Perhaps one of the most potentially significant applications of bFGF is related to its reported ability to induce angiogenesis. The cDNA of native rat FGF-2 (Ala11-Ser154) was cloned from total RNA derived from a rat embryo using standard protocols.
Endotoxin Levels
< 0.1 ng per µg of rat FGF-2
Length [aa]
145
Molecular Weight
16.34 kDa
mRNA RefSeq
NM_019305.2
N Terminal Sequence
ALPEDGGGAFPP
Protein RefSeq
NP_062178.1
Protein Sequence
ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity Confirmation
> 98% by SDS-PAGE & visualized by silver stain
Reconstitution
The rat FGF-2 is supplied in lyophilized form and can be reconstituted with ddH2O at 50 µg/mL. This solution can be diluted into other buffered solutions or stored frozen for future use.
Stability And Storage
The lyophilized rat FGF-2, though stable at room temperature, is best stored in working aliquots at -20 °C to -70 °C
Synonyms
Fgf2; bFGF; Fgf-2
Uniprot ID
P13109

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen