Vergleich

Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) Protein Europäischer Partner

ArtNr RP00474-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 1000 ug 100 ug 10 ug 500 ug 50 ug
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE;> 95% by HPLC
NCBI Fc gamma RIIIB/CD16b (NA1)
Alias CD16,Fc gamma RIIIB,FCG3,FCGR3B,FcgRIIIB,FCRIIIB,IGFR3,CD16b (NA2),CD16B,FCG3B,FCG3,FCGR3,FCR-10
Lieferbar
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
22.52 kDa
Description
Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Ser200) of Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) (Accession #O75015) fused with a C-His tag at the C-terminus.
Background
Human Fc gamma RIIIB/CD16b Protein is a receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Gly17-Ser200(NA1)
Route
C-His
Manufacturer - Research Area
Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq
GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
Protein Formulation
Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
22.52 kDa
Gene Symbol
Fc gamma RIIIB/CD16b (NA1)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen