Recombinant Human IL-9 Protein

ArtNr	RP02891-20ug
Hersteller	Abclonal
Menge	20 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Kategorie	Oncology By Cell Type Hematology Lymphoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
NCBI	IL9
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	P40,HP40,IL-9；IL9
Lieferbar
Manufacturer - Applications	<0.1EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	14.12 kDa
Description	Recombinant Human IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Ile144) of human IL9 (Accession #NP_000581.1) fused with and no tag.
Background	Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Gln19-Ile144
Route	NO-tag
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Bioactivity	Measured in a cell proliferation assay using M07e human megakaryocytic leukemic cells. The ED50 for this effect is 0. 28-1. 12 ng/mL, corresponding to a specific activity of 8. 9×10⁵~3. 6×10⁶ units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size	14.12 kDa
Gene Symbol	IL9

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP02891-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern