Vergleich

Alpha-Synuclein, 1-95

ArtNr RPE-S-1012-1
Hersteller rPeptide
Menge 0.5 mg
Kategorie
Typ Proteins
Format Lyophilized
Specific against other
Purity >95% by SDS-PAGE
Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Human, Native and Mutant Synucleins Recombinant, E. Coli
Shipping Temperature
Ambient
Storage Conditions
-20°C
Description
A deletion Mutant of α-synuclein (amino acids 1-95), which contains the N-terminal amphipathic domain and the NAC region. Alpha-Synuclein (α-Synuclein) is a 14 kD (140 amino acids) acidic presynaptic protein. It is a major component of Parkinson’s disease aggregates and is implicated in the pathogenesis of Parkinson’s Disease and related neurodegenerative disorders. α-Synuclein accumulates in the brains of sporadic Parkinson’s disease patients as a major component of Lewy bodies, which are intraneuronal cytoplasmic inclusions characteristic of Parkinson’s disease. α-Synuclein appears to associate with other proteins that aggregate and is found in β-amyloid plaques and neuritic tangles in Alzheimer’s disease.
Physical State
White lyophilized powder
Territory
This product is only available for customers from Austria or Switzerland!

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen