Vergleich

DLAT(Dihydrolipoyllysine-residue Acetyltransferase Component of Pyruvate Dehydrogenase Complex,Mitochondrial,70kD Mitochondrial Autoantigen of Primary Biliary Cirrhosis,PBC,Dihydrolipoamide Acetyltransferase Component of

ArtNr USB-137923
Hersteller United States Biological
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Format Lyophilized
Applikationen WB, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris)
Host Rabbit
Isotype IgG
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Pab
Manufacturer - Category
Antibodies / Antibodies-Enzymes, Dehydrogenase
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
EU Commodity Code
30021010
Immunogen
Synthetic peptide corresponding to WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR
Specificity
Recognizes DLAT. Species Crossreactivity: Human, mouse, rat and canine.
Description
DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Applications:
Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Western Blot: 5ug/ml
Immunohistochemistry: 4-8ug/ml
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Manufacturer - Full Name
DLAT (Dihydrolipoyllysine-residue Acetyltransferase Component of Pyruvate Dehydrogenase Complex, Mitochondrial, 70kD Mitochondrial Autoantigen of Primary Biliary Cirrhosis, PBC, Dihydrolipoamide Acetyltransferase Component of Pyruvate Dehydrogenase C

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 27.11.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen