ACE (Angiotensin-converting Enzyme, Dipeptidyl Carboxypeptidase I, Kininase II, CD143, Angiotensin-converting Enzyme, Soluble Form, DCP, DCP1)

Antibodies / Antibodies-Enzymes, Carboxypeptidase

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa592-701 from human ACE (AAH36375) with GST tag. MW of the GST tag alone is 26kD.

ACE is an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes-the somatic form and the testicular form that are equally active.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYM

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.