BRK (Protein-tyrosine Kinase 6, Breast Tumor Kinase, Tyrosine-protein Kinase BRK, PTK6, FLJ42088)

Mab

IgG2b, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa342-452, from human PTK6 (NP_005966) with GST tag. MW of the GST tag alone is 26kD.

Breast tumor kinase, Brk (also known as PTK6), is a member of intracellular tyrosine kinase family that is thought to be related to Src family of tumor related kinases. Brk is expressed in breast carcinomas but not in normal breast tissue. The presence of Brk in the nucleus appears to be linked to suppression of tumor progression and has been shown to undergo autophosphorylation.

Applications:
Suitable for use in ELISA and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
YLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.