CD178 (Apoptosis Antigen Ligand, APT1LG1, APTL, CD95 Ligand, CD95L, CD95-L, FAS Antigen Ligand, Fas Ligand, FASL, FASLG, Tumor Necrosis Factor Ligand Superfamily Member 6, TNFSF6)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.4.

Full length recombinant corresponding to aa1-281 from CD178 with GST tag. MW of the GST tag alone is 26kD.

FAS Ligand (FASL) is a 40kD type II membrane protein belonging to the tumor necrosis factor family, which induces apoptosis by binding to its receptor, Fas. The human FasL gene consists of approximately 8kb and is split into four exons. This gene consists of 281aa with a calculated M(r) of 31, 759 and was mapped on chromosome 1q23. It has an identity of 76.9% at the aa sequence level with mouse FasL. The FAS and FASL system plays a key role in regulating apoptotic cell death and corruption of this signalling pathway has been shown to participate in immune escape and tumorigenesis. FAS and FASL triggered apoptosis pathway plays an important role in human carcinogenesis. This system may also play a role in modulating the genetic susceptibility of mouse strains to develop T-cell lymphoblastic lymphomas.

Applications:
Suitable for use in Immunofluorescence, Western Blot and ELISA. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.