GTF2H2 (General Transcription Factor IIH Subunit 2, General Transcription Factor IIH Polypeptide 2, TFIIH Basal Transcription Factor Complex p44 Subunit, Basic Transcription Factor 2 44kD Subunit, BTF2-p44, BTF2P44)

Antibodies / Antibodies-Transcription Factors

-20°C

Supplied as a liquid in PBS, pH 7.2.

Full length human GTF2H2, aa1-395 (NP_001506.1).

GTF2H2 is the 44kD subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.