GTF2H4 (General Transcription Factor IIH Subunit 4, Basic Transcription Factor 2 52kD Subunit, BTF2 p52, General Transcription Factor IIH Polypeptide 4, TFIIH Basal Transcription Factor Complex p52 Subunit)

Mab

IgG2b, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa363-462 from human GTF2H4 (AAH04935.1) with GST tag. MW of the GST tag alone is 26kD.

Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.