IL33 (C9orf26, IL1F11, NFHEV, Interleukin-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor from High Endothelial Venules, DKFZp586H0523, DVS27, NF-HEV, RP11-575C20.2)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa171-270 from human C9orf26 (NP_254274) with GST tag. MW of the GST tag alone is 26kD.

Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Induces T helper type 2-associated cytokines.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
NESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSE

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.