LUC7L (LUC7L1, Putative RNA-binding Protein Luc7-like 1, Putative SR Protein LUC7B1, SR+89, FLJ10231)

Antibodies / Antibodies-RNA Binding Proteins

-20°C

Supplied as a liquid in PBS, pH 7.4.

Partial recombinant corresponding to aa1-110 from human LUC7L with GST tag. MW of the GST tag alone is 26kD.

May bind to RNA via its Arg/Ser-rich domain.

Applications:
Suitable for use in Immunofluorescence, Immunoprecipitation, ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAE

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.