PRPF31 (Pre-mRNA-processing Factor 31, U4/U6 Small Nuclear Ribonucleoprotein Prp31, PRP31, hPrp31, RP11, Serologically Defined Breast Cancer Antigen NY-BR-99, U4/U6 snRNP 61kD Protein, Protein 61K)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa400-500 from human PRPF31 (NP_056444) with GST tag. MW of the GST tag alone is 26kD.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.