ATPase H+ Transporting Lysosomal Accessory Protein 1 (ATP6AP1,16A,Ac45,ATPase H+ Transporting Lysosomal (Vacuolar Proton Pump) Subunit 1,ATP6S1,ATPase H+ Transporting Lysosomal Interacting Protein 1,ATP6IP1,CF2,H-ATPase

Antibodies / Antibodies-Enzymes, Synthase

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added (Azide free).

Partial recombinant protein corresponding to a portion of corresponding to a portion of amino acids within aa51-151 of human ATP6AP1 (NP_001174), with GST tag. MW of GST tag alone is 26kD.

This gene encodes a component of a multisubunit enzyme (1mD MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq]

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. . For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.