Vergleich

CCR4-Not Transcription Complex, Subunit 2 (CNOT2, CDC36, HSPC131, Negative Regulator of Transcription Subunit 2 Homolog, NOT2H)

ArtNr USB-C2099-68W
Hersteller United States Biological
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, Dot
Clon 2191C2a
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a
Purity Purified by Protein G affinity chromatography from hybridoma culture supernatant
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Transcription Factors
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
EU Commodity Code
30021010
Immunogen
Partial sequence of recombinant full-length protein to human CCR4-Not Transcription Complex, Subunit 2 corresponding to amino acids within the internal portion of the protein. Immunogen sequence: FPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLP
Specificity
Recognizes human CCR4-Not Transcription Complex, Subunit 2.
Description
The CCR4-Not complex is a highly conserved regulator of mRNA metabolism.

Applications:
Suitable for use in Western Blot and Dot Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen