Vergleich

MTCO2 Rabbit pAb Europäischer Partner

ArtNr A11154-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
NCBI mt-Co2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias COX2,MTCO2
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
Predicted to enable copper ion binding activity and oxidoreductase activity. Predicted to contribute to cytochrome-c oxidase activity. Predicted to be involved in ATP synthesis coupled electron transport; positive regulation of cellular biosynthetic process; and positive regulation of necrotic cell death. Located in mitochondrion. Is expressed in embryo; epiblast; heart; liver; and metanephros. Orthologous to several human genes including MTCO2P12 (MT-CO2 pseudogene 12).
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 101-200 of mouse MTCO2 (NP_904331.1).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:100 - 1:500|IF/ICC, 1:50 - 1:200
Protein Size
26kDa
Route
Synthetic peptide
Manufacturer - Research Area
Cancer, Signal Transduction, Endocrine & Metabolism, Mitochondrial metabolism, Cytochromes, Mitochondrial markers, Oxidative phosphorylation, Neuroscience, Neurodegenerative Diseases

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen