SRGAP2 Rabbit pAb

ArtNr	A19512-500uL
Hersteller	Abclonal
Menge	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Kategorie	Oncology Neuroscience Neural Signaling Antibodies By Cell Type Cell Biology Cytoskeleton Western Blot ELISA Primary Antibodies Astrocytoma Immunostaining small GTPases Rho Subfamily
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	GVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS
NCBI	SRGAP2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FNBP2,SRGAP3,SRGAP2A,ARHGAP34,SRGAP2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	121kDa
Background	This locus encodes a member of the SLIT-ROBO Rho GTPase activating protein family. The encoded protein stimulates GTPase activity of Rac1, and plays a role in cortical neuron development. This locus has several paralogs on human chromosome 1 resulting from segmental duplication. While this locus itself is conserved among various species, the paralogs are found only in the genus Homo, and not in the genomes of non-human great apes. Alternatively spliced transcript variants have been described for this locus.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 790-900 of human SRGAP2 (NP_056141.2).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	121kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins, Neuroscience.
Antigen Seq	GVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS
Manufacturer - Gene ID (Human)	23380
Expected Protein Size	121kDa
Gene Symbol	SRGAP2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A19512-500uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 18.12.2025