« Zurück
Startseite /
[KO Validated] PRMT4/CARM1 Rabbit mAb

[KO Validated] PRMT4/CARM1 Rabbit mAb

ArtNr	A21106-20uL
Hersteller	Abclonal
Menge	20 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, IP, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	GSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNT
NCBI	CARM1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	PRMT4,M1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	66kDa
Background	This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IP, 1:500 - 1:1000
Protein Size	66kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Epigenetic writers and erasers of core Histones, Nuclear Receptor Signaling, Nuclear hormone receptors, Cancer, Tumor suppressors, p53 pathway, Signal Transduction, Cell Biology Developmental Biology, Cell Cycle, Cell cycle inhibitors, Endocrine Metabolism, Lipid Metabolism.
Antigen Seq	GSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNT
Manufacturer - Gene ID (Human)	10498
Expected Protein Size	66kDa
Gene Symbol	CARM1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A21106-20uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 uL

lieferbar

Lieferung vsl. bis 18.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern