« Zurück
Startseite /
[KO Validated] SMARCB1/SNF5 Rabbit mAb

[KO Validated] SMARCB1/SNF5 Rabbit mAb

ArtNr	A23466-1000uL
Hersteller	Abclonal
Menge	1000 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Oncology Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Sarcoma Immunohistochemistry Immunoprecipitation Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Typ	Antibody Monoclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
NCBI	SMARCB1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	RDT,CSS3,INI1,SNF5,Snr1,BAF47,INI-1,MRD15,RTPS1,Sfh1p,hSNFS,SNF5L1,SWNTS1,PPP1R144,F5
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	44kDa
Background	The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 275-375 of human SMARCB1/SNF5 (NP_003064.2).
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Chromatin Remodeling, Cancer, Tumor suppressors, Cell Biology Developmental Biology, Apoptosis.
Antigen Seq	LVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRM
Manufacturer - Gene ID (Human)	6598
Expected Protein Size	44kDa
Gene Symbol	SMARCB1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A23466-1000uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 uL

lieferbar

Lieferung vsl. bis 27.11.2025