CD8A Rabbit mAb

ArtNr	A23953-500uL
Hersteller	Abclonal
Menge	500 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Oncology Antibodies By Cell Type Hematology Leukemia Flow Cytometry Immunohistochemistry Western Blot ELISA Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Applikationen	WB, FC, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
NCBI	Cd8a
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Eukaryota,Metazoa,Chordata,Craniata,Vertebrata,Euteleostomi,Mammalia,Eutheria,Euarchontoglires,Glires,Rodentia,Myomorpha,Muroidea,Muridae,Murinae,Mus,CD8A
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	27kDa
Background	Enables identical protein binding activity. Acts upstream of or within several processes, including cytotoxic T cell differentiation; defense response to virus; and positive regulation of calcium-mediated signaling. Located in external side of plasma membrane. Is expressed in several structures, including endocrine gland; exocrine gland; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human CD8A (CD8a molecule).
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 28-196 of mouse CD8A(NP_001074579.1)
Recommended Dilution	WB, 1:1000 - 1:4000\|FC, 1:100 - 1:500\|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route	Recombinant protein
Manufacturer - Research Area	Immunology, Adaptive Immunity, T Cells, Cytotoxic Cells.
Antigen Seq	KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
Manufacturer - Gene ID (Human)	925
Expected Protein Size	27kDa
Gene Symbol	Cd8a

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A23953-500uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern