Vergleich

Fibronectin Rabbit pAb Europäischer Partner

ArtNr A25907-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 uL 20 uL 500 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI Fibronectin
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Fn,Fn-1,E330027I09
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Protein Weight
273kDa
Background
Enables peptidase activator activity. Acts upstream of or within several processes, including calcium-independent cell-matrix adhesion; cell-substrate junction assembly; and positive regulation of axon extension. Located in apical plasma membrane and basement membrane. Is expressed in several structures, including alimentary system; cardiovascular system; egg cylinder; embryo mesenchyme; and genitourinary system. Human ortholog(s) of this gene implicated in calcium oxalate nephrolithiasis; membranoproliferative glomerulonephritis; and spondylometaphyseal dysplasia corner fracture type. Orthologous to human FN1 (fibronectin 1).
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2205-2477 of mouse Fibronectin (NP_034363.1).
Route
Recombinant protein
Manufacturer - Research Area
Cardiovascular Angiogenesis Adhesion / ECM Extracellular Matrix Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Protein Fibronectin Stem Cell Lineage Labeling Ectodermal Stem Cells Neural Stem Cells Extracellular Stem Cells Mesenchymal Stem Cells Osteogenic Cancer Invasion / Microenvironment ECM Extracellular Matrix Other Developmental Biology Lineages Specifications Ectodermal.
Antigen Seq
ALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE
Manufacturer - Gene ID (Human)
2335
Expected Protein Size
273kDa
Gene Symbol
Fibronectin

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen