CD19 Rabbit mAb

ArtNr	A26042-500uL
Hersteller	Abclonal
Menge	500 uL
Quantity options	1000 uL 100 uL 20 uL 500 uL
Kategorie	Oncology Antibodies By Cell Type Hematology Leukemia Lymphoma Flow Cytometry Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Typ	Antibody Monoclonal
Applikationen	FC, IF, ICC, ELISA, IHC-P
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
NCBI	Cd19
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Cd19
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	60kDa
Background	Involved in several processes, including B-1 B cell differentiation; positive regulation of phosphatidylinositol 3-kinase activity; and positive regulation of release of sequestered calcium ion into cytosol. Acts upstream of or within B cell receptor signaling pathway. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in liver and spleen. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD19 (CD19 molecule).
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-287 of mouse CD19 (NP_033974.2).
Recommended Dilution	IHC-P, 1:200 - 1:800\|IF/ICC, 1:200 - 1:800\|FC, 1:1000 - 1:2000\|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route	Recombinant protein
Manufacturer - Research Area	Immunology Adaptive Immunity B Cells CDStem Cells Hematopoietic Progenitors Hematopoietic Stem Cells Human Lineage NegativeStem Cells Hematopoietic Progenitors Lymphoid B Lymphocytic Lineage.
Antigen Seq	RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG
Manufacturer - Gene ID (Human)	930
Expected Protein Size	60kDa
Gene Symbol	Cd19

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A26042-500uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern