Vergleich

Histone H2B Rabbit mAb Europäischer Partner

ArtNr A26075-500uL
Hersteller Abclonal
Menge 500 uL
Quantity options 1000 uL 100 uL 20 uL 500 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA, IHC-P, CHIP
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI H2BC21
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias H2B,H2BE,H2BQ,GL105,H2B.1,H2BFQ,H2BGL105,H2B-GL105,HIST2H2BE,Formyl-Histone H2B-K108
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3
Protein Weight
14kDa
Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. The protein has antibacterial and antifungal antimicrobial activity.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human Histone H2B (NP_003519.1).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:2000 - 1:4000|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP, 3 μg antibody for 5μg-10μg of Chromatin
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling.
Antigen Seq
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Manufacturer - Gene ID (Human)
3017/8349
Expected Protein Size
14kDa
Gene Symbol
H2BC21

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen