ZBTB48 Rabbit pAb

ArtNr	A7435-1000uL
Hersteller	Abclonal
Menge	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTR
NCBI	ZBTB48
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HKR3,TZAP,ZNF855,pp9964,ZBTB48
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	77kDa
Background	Enables double-stranded telomeric DNA binding activity; identical protein binding activity; and transcription cis-regulatory region binding activity. Involved in positive regulation of transcription, DNA-templated and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ZBTB48 (NP_005332.1).
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	77kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors.
Antigen Seq	MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEP
Manufacturer - Gene ID (Human)	3104
Expected Protein Size	77kDa
Gene Symbol	ZBTB48

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A7435-1000uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 uL

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern