« Zurück
Startseite /
CD66b/CEACAM8 Rabbit pAb

CD66b/CEACAM8 Rabbit pAb

ArtNr	A8113-1000uL
Hersteller	Abclonal
Menge	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNI
NCBI	CEACAM8
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CD67,CGM6,CD66b,NCA-95,CD66b/CEACAM8
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	38kDa
Background	Enables protein heterodimerization activity. Involved in heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules. Located in cell surface and extracellular space. Biomarker of severe acute respiratory syndrome.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 35-320 of human CD66b/CEACAM8 (NP_001807.2).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	38kDa
Route	Recombinant protein
Manufacturer - Research Area	Immunology Inflammation, CDs.
Antigen Seq	QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Manufacturer - Gene ID (Human)	1088
Expected Protein Size	38kDa
Gene Symbol	CEACAM8

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A8113-1000uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 uL

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern