CD3H Rabbit mAb

ArtNr	A11157-20ul
Hersteller	Abclonal
Menge	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Antibodies By Cell Type Hematology Leukemia Lymphoma Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, FC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
NCBI	CD247
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	T3Z,CD3H,CD3Q,CD3Z,TCRZ,IMD25,CD3ZETA,CD3-ZETA
Similar products	CD3Z, CD3H, CD3Q, CD3-ZETA, T3Z, TCRZ, IMD25
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	WB, IHC-P, FC (intra), ELISA
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	19kDa
Background	The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|FC(Intra), 1:50 - 1:200
Protein Size	19kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Immunology Inflammation, CDs, T Cell Receptor Signaling Pathway.
Antigen Seq	QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Manufacturer - Gene ID (Human)	919
Expected Protein Size	19kDa
Gene Symbol	CD247

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A11157-20ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ul

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern