« Zurück
Startseite /
δ-Catenin/p120 Catenin Rabbit mAb

δ-Catenin/p120 Catenin Rabbit mAb

ArtNr	A11399-50ul
Hersteller	Abclonal
Menge	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Neuroscience Neural Adhesion Molecules Antibodies Immunohistochemistry Immunoprecipitation Western Blot ELISA Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Applikationen	WB, IP, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
NCBI	CTNND1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CAS,p120,BCDS2,CTNND,P120CAS,P120CTN,p120(CAS),p120(CTN),δ-Catenin/p120 Catenin
Similar products	CAS, p120, CTNND, P120CAS, P120CTN, p120(CAS), p120(CTN)
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	108kDa
Background	This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 869-968 of human δ-Catenin/p120 Catenin (O60716).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IP, 1:500 - 1:1000
Protein Size	108kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Protein phosphorylation, Signal Transduction, G protein signaling, Cell Biology Developmental Biology, Cell Adhesion, Tight Junctions, Cytoskeleton, Microfilaments, Wnt ��-Catenin Signaling Pathway, Stem Cells.
Antigen Seq	TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
Manufacturer - Gene ID (Human)	1500
Expected Protein Size	108kDa
Gene Symbol	CTNND1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A11399-50ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 18.12.2025