Vergleich

PLA2G6 Rabbit pAb Europäischer Partner

ArtNr A14808-100ul
Hersteller Abclonal
Menge 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence GNTPLHLAMSKDNMEMVKALIVFGAEVDTPNDFGETPALIASKISKLITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHPLFSLDRTQPPAISLNNL
NCBI Pla2g6
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias iPLA2,PNPLA9,iPLA2beta,iPLA(2)beta,PLA2G6
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
Enables calcium-independent phospholipase A2 activity; palmitoyl-CoA hydrolase activity; and serine hydrolase activity. Involved in positive regulation of insulin secretion involved in cellular response to glucose stimulus. Predicted to be located in centriolar satellite; cytosol; and extracellular space. Predicted to be active in mitochondrion. Is expressed in 1st branchial arch maxillary component; olfactory placode; otic pit; and trunk somite. Used to study neurodegeneration with brain iron accumulation 2a. Human ortholog(s) of this gene implicated in dystonia 12; neuroaxonal dystrophy; and neurodegenerative disease (multiple). Orthologous to human PLA2G6 (phospholipase A2 group VI).
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 350-450 of mouse PLA2G6 (NP_001185952.1).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
83kDa/89kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Signal Transduction

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen