Vergleich

DKK2 Rabbit pAb Europäischer Partner

ArtNr A14874-100ul
Hersteller Abclonal
Menge 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence CMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI
NCBI DKK2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DKK-2, DKK2
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist or antagonist of Wnt/beta-catenin signaling, depending on the cellular context and the presence of the co-factor kremen 2. Activity of this protein is also modulated by binding to the Wnt co-receptor LDL-receptor related protein 6 (LRP6).
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human DKK2 (NP_055236.1).
Recommended Dilution
WB, 1:500 - 1:2000|IF/ICC, 1:100 - 1:500
Protein Size
28kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Cell Biology Developmental Biology, Wnt ��-Catenin Signaling Pathway, Stem Cells

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen