HTR1B Rabbit pAb

ArtNr	A18285-20ul
Hersteller	Abclonal
Menge	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Metabolism Regulation of Appetite Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQ
NCBI	HTR1B
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	S12,5-HT1B,HTR1D2,HTR1DB,5-HT-1B,5-HT1DB,5-HT-1D-beta,HTR1B
Similar products	5-HT-1B, HTR1B, HTR1DB, S12, 5-HT1B, 5-HT1DB, HTR1D2, 5-HT-1D-beta
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	44kDa
Background	The protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates second messengers that inhibit the activity of adenylate cyclase and manage the release of serotonin, dopamine, and acetylcholine in the brain. The encoded protein may be involved in several neuropsychiatric disorders and therefore is often a target of antidepressant and other psychotherapeutic drugs.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-390 of human HTR1B (P28222).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	44kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Endocrine Metabolism, Endocrine and metabolic diseases, Obesity, Neuroscience.
Antigen Seq	MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Manufacturer - Gene ID (Human)	3351
Expected Protein Size	44kDa
Gene Symbol	HTR1B

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A18285-20ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ul

lieferbar

Lieferung vsl. bis 02.10.2025