« Zurück
Startseite /
Glucosylceramidase beta (GBA) Rabbit mAb

Glucosylceramidase beta (GBA) Rabbit mAb

ArtNr	A19057-20ul
Hersteller	Abclonal
Menge	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Testicular & Prostate Cancer
Typ	Antibody Monoclonal
Applikationen	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	VDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ
NCBI	GBA1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	GBA,GCB,GLUC,Glucosylceramidase beta (GBA)
Similar products	GBA, GLUC, GBA1, GCB
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	60kDa
Background	This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Human, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase beta (GBA) (P04062).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	60kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Cancer, Signal Transduction, Endocrine Metabolism, Lipid Metabolism, Neuroscience, Cell Type Marker, Neurodegenerative Diseases, Dopamine Signaling in Parkinson's Disease.
Antigen Seq	VDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ
Manufacturer - Gene ID (Human)	2629
Expected Protein Size	60kDa
Gene Symbol	GBA1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A19057-20ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ul

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern