« Zurück
Startseite /
PAI-1/Serpin E1 Rabbit mAb

PAI-1/Serpin E1 Rabbit mAb

ArtNr	A19096-50ul
Hersteller	Abclonal
Menge	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Cell Biology Cell Status Western Blot ELISA Senescence Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	SKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFS
NCBI	SERPINE1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	PAI,PAI1,PAI-1,PLANH1,PAI-1/Serpin E1
Similar products	SERPINE1, PAI-1, PAI1, PLANH1, PAI
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	45kDa
Background	This gene encodes a member of the serine proteinase inhibitor (serpin) superfamily. This member is the principal inhibitor of tissue plasminogen activator (tPA) and urokinase (uPA), and hence is an inhibitor of fibrinolysis. The protein also functions as a component of innate antiviral immunity. Defects in this gene are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1 deficiency), and high concentrations of the gene product are associated with thrombophilia.
Manufacturer - Cross Reactivity	Human
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PAI-1/Serpin E1 (P05121).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	45kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Cancer, Tumor biomarkers, Signal Transduction, Cell Biology Developmental Biology, Ubiquitin, Endocrine Metabolism, Endocrine and metabolic diseases, Cardiovascular, Angiogenesis, Blood.
Antigen Seq	SKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFS
Manufacturer - Gene ID (Human)	5054
Expected Protein Size	45kDa
Gene Symbol	SERPINE1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A19096-50ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern