« Zurück
Startseite /
Calmodulin 1/2/3 Rabbit mAb

Calmodulin 1/2/3 Rabbit mAb

ArtNr	A4885-50ul
Hersteller	Abclonal
Menge	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Typ	Antibody Monoclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
NCBI	CALM1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CALML2,CAMI,CPVT4,DD132,LQT14,PHKD,caM,Calmodulin 1/2/3
Similar products	CAMI, DD132, PHKD, CALML2, caM, CPVT4, LQT14
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	16kDa
Background	This gene encodes a member of the EF-hand calcium-binding protein family. It is one of three genes which encode an identical calcium binding protein which is one of the four subunits of phosphorylase kinase. Two pseudogenes have been identified on chromosome 7 and X. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	16kDa
Route	Synthetic Peptide
Manufacturer - Research Area	B Cell Receptor Signaling Pathway, Carbohydrate metabolism, Cell Biology & Developmental Biology, Cell Cycle, Cell Cycle_Centrosome, Cytoskeleton, Cytoskeleton_Actins, Endocrine & Metabolism, ErbB-HER Signaling Pathway, G protein signaling, Immunology & Inflammation, Kinase, Neurodegenerative Diseases, Neuroscience, Signal Transduction, T Cell Receptor Signaling Pathway.
Antigen Seq	LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Manufacturer - Gene ID (Human)	801/805/808
Expected Protein Size	16kDa
Gene Symbol	CALM1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A4885-50ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 18.12.2025