Vergleich

PKC epsilon Rabbit mAb Europäischer Partner

ArtNr A4998-200ul
Hersteller Abclonal
Menge 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence RSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
NCBI PRKCE
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias PKCE,nPKC-epsilon,PKC epsilon
Similar products nPKC-epsilon, PKCE
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
84kDa
Background
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been shown to be involved in many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Knockout studies in mice suggest that this kinase is important for lipopolysaccharide (LPS)-mediated signaling in activated macrophages and may also play a role in controlling anxiety-like behavior.
Manufacturer - Cross Reactivity
Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PKC epsilon (Q02156).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
84kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, Kinase, Serine threonine kinases, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Inhibition of Apoptosis, TGF-b-Smad Signaling Pathway, Immunology Inflammation, B Cell Receptor Signaling Pathway.
Antigen Seq
RSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
Manufacturer - Gene ID (Human)
5581
Expected Protein Size
84kDa
Gene Symbol
PRKCE

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ul
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 02.10.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen