MYL2 Rabbit mAb

ArtNr	A8742-50ul
Hersteller	Abclonal
Menge	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Neuroscience Neural Lineage Markers Antibodies Cell Biology Cell Status Necrosis Cytoskeleton Western Blot ELISA Immunofluorescence Immunocytochemistry Motor proteins Primary Antibodies Immunostaining Immunochemistry
Typ	Antibody Monoclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	DEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NCBI	MYL2
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	MLC2,CMH10,MFM12,MLC-2,MLC-2v,MLC-2s/v,MYL2
Similar products	MLC2, CMH10, MLC-2s/v
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	19kDa
Background	This gene encodes a major sarcomeric protein in mammalian striated muscle. The encoded protein plays a role in embryonic heart muscle structure and function, while phosphorylation of the encoded protein is involved in cardiac myosin cycling kinetics, torsion and function in adults. Mutations in this gene are associated with hypertrophic cardiomyopathy 10 and infant-onset myopathy.
Manufacturer - Cross Reactivity	Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 67-166 of human MYL2 (P10916).
Recommended Dilution	WB, 1:500 - 1:1000\|IF/ICC, 1:50 - 1:200
Protein Size	19kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Motor Proteins, Actins, Cardiovascular, Heart, Contractility.
Antigen Seq	DEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Manufacturer - Gene ID (Human)	4633
Expected Protein Size	19kDa
Gene Symbol	MYL2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A8742-50ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 18.12.2025