eIF3B Rabbit mAb

ArtNr	A9143-200ul
Hersteller	Abclonal
Menge	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Antibodies Western Blot Immunofluorescence Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	VPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRL
NCBI	EIF3B
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	PRT1, EIF3S9, EIF3-ETA, EIF3-P110, EIF3-P116, eIF3B
Similar products	EIF3S9, PRT1, EIF3-ETA, EIF3-P110, EIF3-P116
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background	Enables RNA binding activity. Contributes to translation initiation factor activity. Involved in several processes, including IRES-dependent viral translational initiation; translational initiation; and viral translational termination-reinitiation. Located in extracellular exosome. Part of eukaryotic translation initiation factor 3 complex.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human eIF3B (NP_003742.2).
Recommended Dilution	WB, 1:500 - 1:1000\|IF/ICC, 1:50 - 1:200
Protein Size	93kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A9143-200ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ul

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern