GABARAPL2 Rabbit mAb

ArtNr	A9585-100ul
Hersteller	Abclonal
Menge	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Neuroscience Neural Lineage Markers Antibodies Western Blot ELISA Primary Antibodies Immunostaining Glial Cell Markers
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	GSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
NCBI	GABARAPL2
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ATG8,GEF2,ATG8C,GEF-2,GATE16,GATE-16,FLC3A,GABARAPL2
Similar products	ATG8, ATG8C, GATE-16, GATE16, GEF2, GEF-2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	14kDa
Background	Enables ubiquitin protein ligase binding activity. Involved in negative regulation of proteasomal protein catabolic process and protein localization to endoplasmic reticulum. Located in Golgi membrane and autophagosome membrane.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 38-117 of human GABARAPL2 (P60520).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	14kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Cancer, Signal Transduction, Cell Biology Developmental Biology, Autophagy, Endocrine Metabolism, Mitochondrial metabolism.
Antigen Seq	GSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Manufacturer - Gene ID (Human)	11345
Expected Protein Size	14kDa
Gene Symbol	GABARAPL2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A9585-100ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern