Vergleich

FoxO3a Rabbit pAb Europäischer Partner

ArtNr A0102-200ul
Hersteller Abclonal
Menge 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence LSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDAD
NCBI Foxo3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Fkhr2,FKHRL1,Foxo3a,1110048B16Rik,2010203A17Rik,FOXO3A
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight
71kDa
Background
Enables DNA binding activity; DNA-binding transcription factor activity, RNA polymerase II-specific; and mitochondrial transcription factor activity. Involved in several processes, including mitochondrial transcription; positive regulation of muscle atrophy; and positive regulation of pri-miRNA transcription by RNA polymerase II. Acts upstream of or within several processes, including extrinsic apoptotic signaling pathway in absence of ligand; female gonad development; and neuronal stem cell population maintenance. Located in cytosol; mitochondrial outer membrane; and nucleus. Part of protein-containing complex. Colocalizes with mitochondrial matrix. Is expressed in several structures, including alimentary system; brain; early embryo; genitourinary system; and hemolymphoid system. Used to study dermoid cyst of ovary. Orthologous to human FOXO3 (forkhead box O3).
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 558-635 of mouse FOXO3A (NP_062714.1).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
71kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Transcription Factors, Signal Transduction, G protein signaling, G2/M DNA Damage Checkpoint, MAPK-Erk Signaling Pathway, Cell Biology & Developmental Biology, Autophagy, Cell Cycle, G1/S Checkpoint, Endocrine & Metabolism, Insulin Receptor Signaling Pathway, Immunology & Inflammation, B Cell Receptor Signaling Pathway.
Antigen Seq
LSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDAD
Manufacturer - Gene ID (Human)
2309
Expected Protein Size
71kDa
Gene Symbol
Foxo3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen