« Zurück
Home /
TEAD1 Rabbit pAb

TEAD1 Rabbit pAb

ArtNr	A13366-50ul
Hersteller	Abclonal
Menge	50ul
Kategorie	Antibodies Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies CHiP
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA, IHC-P, CHIP
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	APSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
NCBI	TEAD1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TEAD1;AA;NTEF-1;REF1;TCF-13;TCF13;TEAD-1;TEF-1
Lieferbar
Background	This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEAD1 (NP_068780.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200\|ChIP, 1:20 - 1:50
Protein Size	48kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Cell Biology Developmental Biology, Cell Adhesion, Wnt ��-Catenin Signaling Pathway, Cardiovascular, Heart, Cardiogenesis
Gene Symbol	TEAD1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 25.10.2024

Express-Lieferung: 10 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail