EPHB6 Rabbit pAb

ArtNr	A14728-100ul
Hersteller	Abclonal
Menge	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Antibodies Western Blot Primary Antibodies Neuronal Cell Markers
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	HFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
NCBI	EPHB6
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HEP,EPHB6
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	111kDa
Background	This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 615-729 of human EPHB6 (NP_001267724.2).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	111kDa
Route	Recombinant Protein
Manufacturer - Research Area	Signal Transduction, Kinase, Tyrosine kinases, Neuroscience, Cell Type Marker, Neuron marker.
Antigen Seq	HFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
Manufacturer - Gene ID (Human)	2051
Expected Protein Size	111kDa
Gene Symbol	EPHB6

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A14728-100ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern