Vergleich

TRIM9 Rabbit pAb Europäischer Partner

ArtNr A13896-50ul
Hersteller Abclonal
Menge 50 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ
NCBI TRIM9
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RNF91,SPRING,TRIM9
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight
79kDa
Background
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternate splicing of this gene generates two transcript variants encoding different isoforms.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TRIM9 (NP_055978.4).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
79kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling.
Antigen Seq
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ
Manufacturer - Gene ID (Human)
114088
Expected Protein Size
79kDa
Gene Symbol
TRIM9

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ul
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 20.11.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen