Uhrf2 Rabbit pAb

ArtNr	A2344-200ul
Hersteller	Abclonal
Menge	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Antibodies Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies By Organ Lung Cancer Colorectal Cancer Immunostaining
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDP
NCBI	Uhrf2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Nirf,2310065A22Rik,D130071B19Rik,Uhrf2
Similar products	UHRF2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	90kDa
Background	Enables histone binding activity. Predicted to be involved in several processes, including maintenance of DNA methylation; protein autoubiquitination; and regulation of cell cycle. Located in heterochromatin and nucleus. Is expressed in several structures, including central nervous system; ear; early conceptus; female reproductive system; and urinary system. Orthologous to human UHRF2 (ubiquitin like with PHD and ring finger domains 2).
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 76-359 of mouse Uhrf2 (NP_659122.2).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	90kDa
Route	Recombinant protein
Manufacturer - Research Area	Cell Biology & Developmental Biology, Apoptosis, Cell Cycle, Cell cycle inhibitors, Ubiquitin.
Antigen Seq	DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDPECDLCGGDPDKTCHMCSCHKCGEKRDPNM
Manufacturer - Gene ID (Human)	115426
Expected Protein Size	90kDa
Gene Symbol	Uhrf2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A2344-200ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern