Vergleich

PIK3C2A Rabbit pAb Europäischer Partner

ArtNr A8526-20ul
Hersteller Abclonal
Menge 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, IP, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPL
NCBI PIK3C2A
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CPK, OCSKD, PI3-K-C2A, PI3K-C2alpha, PI3K-C2-alpha, PI3-K-C2(ALPHA), PIK3C2A
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PIK3C2A (NP_002636.2).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:100|IF/ICC, 1:50 - 1:100|IP, 1:50 - 1:100
Protein Size
191kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Signal Transduction, Kinase, PI3K-Akt Signaling Pathway, mTOR Signaling Pathway, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, MAPK-JNK Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Inhibition of Apoptosis, Autophagy, Cell Adhesion, Cytoskeleton, Microtubules, Actins, TGF-b-Smad Signaling Pathway, ESC Pluripotency and Differentiation, Endocrine Metabolism, Lipid Metabolism, AMPK Signaling Pathway, Warburg Effect, Immunology Inflammation, T Cell Receptor Signaling Pathway, Jak-Stat-IL-6 Receptor Signaling Pathway, NF-kB Signaling Pathway, Toll-like Receptor Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, TLR Signaling, Cardiovascular, Angiogenesis

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen